ANTXR1 Antikörper (Middle Region)

Produktnummer ABIN635911

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ANTXR1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für ANTXR1 Antikörper (Middle Region) (ABIN635911)

Target: ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANTXR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ANTXR1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ANTXR1 antibody was raised against the middle region of ANTXR1

Aufreinigung: Affinity purified

Immunogen: ANTXR1 antibody was raised using the middle region of ANTXR1 corresponding to a region with amino acids VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANTXR1 Blocking Peptide, (ABIN5612093), is also available for use as a blocking control in assays to test for specificity of this ANTXR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTXR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANTXR1

Target: ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))

Andere Bezeichnung: ANTXR1

Hintergrund: ANTXR1 is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. ANTXR1 has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax.

Molekulargewicht: 60 kDa (MW of target protein)