ANTXR1 Antikörper (Middle Region)
-
- Target Alle ANTXR1 Antikörper anzeigen
- ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ANTXR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ANTXR1 antibody was raised against the middle region of ANTXR1
- Aufreinigung
- Affinity purified
- Immunogen
- ANTXR1 antibody was raised using the middle region of ANTXR1 corresponding to a region with amino acids VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK
- Top Product
- Discover our top product ANTXR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ANTXR1 Blocking Peptide, catalog no. 33R-9794, is also available for use as a blocking control in assays to test for specificity of this ANTXR1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTXR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))
- Andere Bezeichnung
- ANTXR1 (ANTXR1 Produkte)
- Synonyme
- ANTXR1 antikoerper, ATR antikoerper, TEM8 antikoerper, 2310008J16Rik antikoerper, 2810405N18Rik antikoerper, Antrx1 antikoerper, Tem8 antikoerper, anthrax toxin receptor 1 antikoerper, ANTXR1 antikoerper, Antxr1 antikoerper
- Hintergrund
- ANTXR1 is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. ANTXR1 has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax.
- Molekulargewicht
- 60 kDa (MW of target protein)
-