GPR27 Antikörper (Middle Region)
-
- Target Alle GPR27 Antikörper anzeigen
- GPR27 (G Protein-Coupled Receptor 27 (GPR27))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPR27 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GPR27 antibody was raised against the middle region of GPR27
- Aufreinigung
- Affinity purified
- Immunogen
- GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAV
- Top Product
- Discover our top product GPR27 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPR27 Blocking Peptide, catalog no. 33R-5502, is also available for use as a blocking control in assays to test for specificity of this GPR27 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR27 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPR27 (G Protein-Coupled Receptor 27 (GPR27))
- Andere Bezeichnung
- GPR27 (GPR27 Produkte)
- Synonyme
- SREB1 antikoerper, Sreb1 antikoerper, G protein-coupled receptor 27 antikoerper, gpr27 antikoerper, GPR27 antikoerper, Gpr27 antikoerper
- Hintergrund
- GPR27 belongs to the G-protein coupled receptor 1 family. GPR27 is an orphan receptor. It is a possible candidate for amine-like G-protein coupled receptor.
- Molekulargewicht
- 40 kDa (MW of target protein)
-