EMID1 Antikörper (C-Term)

Produktnummer ABIN635896

Produktdetails anti-EMID1 Antikörper

Target: EMID1 (EMI Domain Containing 1 (EMID1))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EMID1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EMID1 antibody was raised against the C terminal of EMID1

Aufreinigung: Affinity purified

Immunogen: EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EMID1 Blocking Peptide, catalog no. 33R-9201, is also available for use as a blocking control in assays to test for specificity of this EMID1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMID1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EMID1

Target: EMID1 (EMI Domain Containing 1 (EMID1))

Andere Bezeichnung: EMID1 (EMID1 Produkte)

Synonyme: EMI5 antikoerper, EMU1 antikoerper, AW122071 antikoerper, CO-5 antikoerper, Emu1 antikoerper, RGD1565846 antikoerper, EMI domain containing 1 antikoerper, EMID1 antikoerper, Emid1 antikoerper

Hintergrund: EMID1 contains 1 collagen-like domain and 1 EMI domain. The exact function of EMID1 remains unknown.

Molekulargewicht: 45 kDa (MW of target protein)