EMID1 Antikörper (C-Term)

Produktnummer ABIN635896

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch EMID1 in WB. Er zeigt eine Reaktivität gegenüber Ratte, Human und Maus.

Kurzübersicht für EMID1 Antikörper (C-Term) (ABIN635896)

Target: EMID1 (EMI Domain Containing 1 (EMID1))

Reaktivität: Ratte, Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EMID1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EMID1 Antikörper

Bindungsspezifität: C-Term

Spezifität: EMID1 antibody was raised against the C terminal of EMID1

Aufreinigung: Affinity purified

Immunogen: EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EMID1 Blocking Peptide, (ABIN5613365), is also available for use as a blocking control in assays to test for specificity of this EMID1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMID1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EMID1

Target: EMID1 (EMI Domain Containing 1 (EMID1))

Andere Bezeichnung: EMID1

Hintergrund: EMID1 contains 1 collagen-like domain and 1 EMI domain. The exact function of EMID1 remains unknown.

Molekulargewicht: 45 kDa (MW of target protein)