LMAN2 Antikörper (N-Term)
Kurzübersicht für LMAN2 Antikörper (N-Term) (ABIN635887)
Target
Alle LMAN2 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- LMAN2 antibody was raised against the N terminal of LMAN2
-
Aufreinigung
- Affinity purified
-
Immunogen
- LMAN2 antibody was raised using the N terminal of LMAN2 corresponding to a region with amino acids SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
LMAN2 Blocking Peptide, (ABIN5614476), is also available for use as a blocking control in assays to test for specificity of this LMAN2 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN2 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))
-
Andere Bezeichnung
- LMAN2
-
Hintergrund
- LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
-
Molekulargewicht
- 36 kDa (MW of target protein)
-
Pathways
- SARS-CoV-2 Protein Interaktom
Target
-