NHE7 Antikörper

Produktnummer ABIN635882

Der Kaninchen Polyklonal anti-NHE7 Antikörper wird verwendet zum Nachweis von NHE7 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für NHE7 Antikörper (ABIN635882)

Target: NHE7 (SLC9A7) (Sodium Hydrogen Exchanger 7 (SLC9A7))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NHE7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NHE7 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC9 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC9A7 Blocking Peptide, (ABIN940387), is also available for use as a blocking control in assays to test for specificity of this SLC9A7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NHE7

Target: NHE7 (SLC9A7) (Sodium Hydrogen Exchanger 7 (SLC9A7))

Andere Bezeichnung: SLC9A7

Hintergrund: Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.

Molekulargewicht: 80 kDa (MW of target protein)