UGT1A7 Antikörper (N-Term)

Produktnummer ABIN635878

Produktdetails anti-UGT1A7 Antikörper

Target: UGT1A7 (UDP Glucuronosyltransferase 1 Family, Polypeptide A7 (UGT1A7))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGT1A7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGT1 A7 antibody was raised against the N terminal of µgT1 7

Aufreinigung: Affinity purified

Immunogen: UGT1 A7 antibody was raised using the N terminal of µgT1 7 corresponding to a region with amino acids VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGT1A7 Blocking Peptide, catalog no. 33R-9639, is also available for use as a blocking control in assays to test for specificity of this µgT1A7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGT1A7

Target: UGT1A7 (UDP Glucuronosyltransferase 1 Family, Polypeptide A7 (UGT1A7))

Andere Bezeichnung: UGT1A7 (UGT1A7 Produkte)

Synonyme: UDPGT antikoerper, UDPGT 1-7 antikoerper, UGT-1G antikoerper, UGT1-07 antikoerper, UGT1.7 antikoerper, UGT1G antikoerper, UGT1A10 antikoerper, UGT1A6 antikoerper, UGT1A7 antikoerper, UGT1A8 antikoerper, UGT1A9 antikoerper, UDP glucuronosyltransferase family 1 member A7 antikoerper, UDP glucuronosyltransferase family 1 member A1 antikoerper, UDP glucuronosyltransferase 1 family, polypeptide A7 antikoerper, UGT1A7 antikoerper, UGT1A1 antikoerper, ugt1a7 antikoerper

Hintergrund: UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha