LMF1 Antikörper (N-Term)

Produktnummer ABIN635873

Produktdetails anti-LMF1 Antikörper

Target: LMF1 (Lipase Maturation Factor 1 (LMF1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LMF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LMF1 antibody was raised against the N terminal of LMF1

Aufreinigung: Affinity purified

Immunogen: LMF1 antibody was raised using the N terminal of LMF1 corresponding to a region with amino acids MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LMF1 Blocking Peptide, catalog no. 33R-6372, is also available for use as a blocking control in assays to test for specificity of this LMF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LMF1

Target: LMF1 (Lipase Maturation Factor 1 (LMF1))

Andere Bezeichnung: LMF1 (LMF1 Produkte)

Synonyme: C16orf26 antikoerper, HMFN1876 antikoerper, JFP11 antikoerper, TMEM112 antikoerper, TMEM112A antikoerper, 2400010G15Rik antikoerper, AW822050 antikoerper, Tmem112 antikoerper, cld antikoerper, RGD1310180 antikoerper, lipase maturation factor 1 antikoerper, LMF1 antikoerper, lmf1 antikoerper, LOC100594835 antikoerper, Lmf1 antikoerper

Hintergrund: The protein encoded by this gene resides in the endoplasmic reticulum, and is involved in the maturation and transport of lipoprotein lipase through the secretory pathway. Mutations in this gene are associated with combined lipase deficiency.

Molekulargewicht: 65 kDa (MW of target protein)