MGAT2 Antikörper

Produktnummer ABIN635870

Der Kaninchen-Polyklonal Anti-MGAT2-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von MGAT2 in Proben aus Human, Maus und Ratte. }

Kurzübersicht für MGAT2 Antikörper (ABIN635870)

Target: MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MGAT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MGAT2 Antikörper

Aufreinigung: Affinity purified

Immunogen: MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGAT2 Blocking Peptide, (ABIN936004), is also available for use as a blocking control in assays to test for specificity of this MGAT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGAT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MGAT2

Target: MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))

Andere Bezeichnung: MGAT2

Hintergrund: MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans.

Molekulargewicht: 51 kDa (MW of target protein)