ACPT Antikörper (Middle Region)

Produktnummer ABIN635869

Produktdetails anti-ACPT Antikörper

Target: ACPT (Acid Phosphatase, Testicular (ACPT))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACPT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACPT antibody was raised against the middle region of ACPT

Aufreinigung: Affinity purified

Immunogen: ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACPT Blocking Peptide, catalog no. 33R-9175, is also available for use as a blocking control in assays to test for specificity of this ACPT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACPT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACPT

Target: ACPT (Acid Phosphatase, Testicular (ACPT))

Andere Bezeichnung: ACPT (ACPT Produkte)

Synonyme: EG546967 antikoerper, Gm1432 antikoerper, acid phosphatase 4 antikoerper, ACP4 antikoerper, Acp4 antikoerper

Hintergrund: Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. ACPT has structural similarity to prostatic and lysosomal acid phosphatases.

Molekulargewicht: 43 kDa (MW of target protein)