Neuropilin 1 Antikörper (N-Term)

Produktnummer ABIN635859

Dieses Anti-Neuropilin 1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Neuropilin 1 in WB. Geeignet für Human und Maus.

Kurzübersicht für Neuropilin 1 Antikörper (N-Term) (ABIN635859)

Target: Neuropilin 1 (NRP1)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Neuropilin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Neuropilin 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Neuropilin antibody was raised against the N terminal of NETO2

Aufreinigung: Affinity purified

Immunogen: Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Neuropilin Blocking Peptide, (ABIN938715), is also available for use as a blocking control in assays to test for specificity of this Neuropilin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NETO2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Neuropilin 1

Target: Neuropilin 1 (NRP1)

Andere Bezeichnung: Neuropilin

Hintergrund: NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Regulation of Cell Size, Signaling Events mediated by VEGFR1 and VEGFR2, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals