SLITRK1 Antikörper (N-Term)

Produktnummer ABIN635858

Der Kaninchen Polyklonal Anti-SLITRK1-Antikörper wurde für WB validiert. Er ist geeignet, SLITRK1 in Proben von Ratte, Human und Maus zu detektieren.

Kurzübersicht für SLITRK1 Antikörper (N-Term) (ABIN635858)

Target: SLITRK1 (SLIT and NTRK-Like Family, Member 1 (SLITRK1))

Reaktivität: Ratte, Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLITRK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLITRK1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SLITRK1 antibody was raised against the N terminal of SLITRK1

Aufreinigung: Affinity purified

Immunogen: SLITRK1 antibody was raised using the N terminal of SLITRK1 corresponding to a region with amino acids CDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLITRK1 Blocking Peptide, (ABIN937054), is also available for use as a blocking control in assays to test for specificity of this SLITRK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLITRK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLITRK1

Target: SLITRK1 (SLIT and NTRK-Like Family, Member 1 (SLITRK1))

Andere Bezeichnung: SLITRK1

Hintergrund: Members of the SLITRK family, such as SLITRK1, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, but not SLITRK1, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.

Molekulargewicht: 78 kDa (MW of target protein)