DLK1 Antikörper

Produktnummer ABIN635854

Produktdetails anti-DLK1 Antikörper

Target: DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLK1 Blocking Peptide, catalog no. 33R-8692, is also available for use as a blocking control in assays to test for specificity of this DLK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLK1

Target: DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))

Andere Bezeichnung: DLK1 (DLK1 Produkte)

Synonyme: DELTA1 antikoerper, DL1 antikoerper, Delta antikoerper, DLK antikoerper, DLK-1 antikoerper, Delta1 antikoerper, FA1 antikoerper, PREF1 antikoerper, Pref-1 antikoerper, ZOG antikoerper, pG2 antikoerper, AW742678 antikoerper, DlkI antikoerper, Ly107 antikoerper, Peg9 antikoerper, SCP1 antikoerper, pref-1 antikoerper, Zog antikoerper, delta like canonical Notch ligand 1 antikoerper, delta like non-canonical Notch ligand 1 antikoerper, delta-like 1 homolog (Drosophila) antikoerper, delta-like 1 (Drosophila) antikoerper, DLL1 antikoerper, DLK1 antikoerper, Dll1 antikoerper, Dlk1 antikoerper

Hintergrund: DLK1 may have a role in neuroendocrine differentiation.

Molekulargewicht: 41 kDa (MW of target protein)