DLK1 Antikörper

Produktnummer ABIN635854

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DLK1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für DLK1 Antikörper (ABIN635854)

Target: DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DLK1 Antikörper

Aufreinigung: Affinity purified

Immunogen: DLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLK1 Blocking Peptide, (ABIN5613217), is also available for use as a blocking control in assays to test for specificity of this DLK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLK1

Target: DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))

Andere Bezeichnung: DLK1

Hintergrund: DLK1 may have a role in neuroendocrine differentiation.

Molekulargewicht: 41 kDa (MW of target protein)