SLC22A15 Antikörper (Middle Region)

Produktnummer ABIN635853

Produktdetails anti-SLC22A15 Antikörper

Target: SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC22 A15 antibody was raised against the middle region of SLC22 15

Aufreinigung: Affinity purified

Immunogen: SLC22 A15 antibody was raised using the middle region of SLC22 15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A15 Blocking Peptide, catalog no. 33R-6840, is also available for use as a blocking control in assays to test for specificity of this SLC22A15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A15

Target: SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))

Andere Bezeichnung: SLC22A15 (SLC22A15 Produkte)

Synonyme: FLIPT1 antikoerper, PRO34686 antikoerper, 2610034P21Rik antikoerper, 4930477M19 antikoerper, A530052I06Rik antikoerper, BB219042 antikoerper, solute carrier family 22 member 15 antikoerper, solute carrier family 22 (organic anion/cation transporter), member 15 antikoerper, solute carrier family 22, member 15 antikoerper, SLC22A15 antikoerper, Slc22a15 antikoerper

Hintergrund: Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites.

Molekulargewicht: 59 kDa (MW of target protein)