SLC22A15 Antikörper (Middle Region)

Produktnummer ABIN635853

Dieses Anti-SLC22A15-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SLC22A15 in WB. Geeignet für Human.

Kurzübersicht für SLC22A15 Antikörper (Middle Region) (ABIN635853)

Target: SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC22A15 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC22 A15 antibody was raised against the middle region of SLC22 15

Aufreinigung: Affinity purified

Immunogen: SLC22 A15 antibody was raised using the middle region of SLC22 15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A15 Blocking Peptide, (ABIN5616197), is also available for use as a blocking control in assays to test for specificity of this SLC22A15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A15

Target: SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))

Andere Bezeichnung: SLC22A15

Hintergrund: Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites.

Molekulargewicht: 59 kDa (MW of target protein)