SLC22A15 Antikörper (Middle Region)
-
- Target Alle SLC22A15 Antikörper anzeigen
- SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC22A15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC22 A15 antibody was raised against the middle region of SLC22 15
- Aufreinigung
- Affinity purified
- Immunogen
- SLC22 A15 antibody was raised using the middle region of SLC22 15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK
- Top Product
- Discover our top product SLC22A15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC22A15 Blocking Peptide, catalog no. 33R-6840, is also available for use as a blocking control in assays to test for specificity of this SLC22A15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))
- Andere Bezeichnung
- SLC22A15 (SLC22A15 Produkte)
- Hintergrund
- Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites.
- Molekulargewicht
- 59 kDa (MW of target protein)
-