LRRC15 Antikörper (N-Term)

Produktnummer ABIN635851

Produktdetails anti-LRRC15 Antikörper

Target: LRRC15 (Leucine Rich Repeat Containing 15 (LRRC15))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC15 antibody was raised against the N terminal of LRRC15

Aufreinigung: Affinity purified

Immunogen: LRRC15 antibody was raised using the N terminal of LRRC15 corresponding to a region with amino acids LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC15 Blocking Peptide, catalog no. 33R-5224, is also available for use as a blocking control in assays to test for specificity of this LRRC15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC15

Target: LRRC15 (Leucine Rich Repeat Containing 15 (LRRC15))

Andere Bezeichnung: LRRC15 (LRRC15 Produkte)

Synonyme: cb894 antikoerper, zgc:158286 antikoerper, LIB antikoerper, 5430427N11Rik antikoerper, Lib antikoerper, leucine rich repeat containing 15 antikoerper, leucine-rich repeat-containing protein 15 antikoerper, carboxypeptidase N subunit 2 antikoerper, LRRC15 antikoerper, lrrc15 antikoerper, CpipJ_CPIJ004946 antikoerper, CpipJ_CPIJ005191 antikoerper, CpipJ_CPIJ007745 antikoerper, CPN2 antikoerper, Lrrc15 antikoerper

Hintergrund: LRRC15 may contribute to regulation of cell-matrix adhesion interactions with respect to astrocyte recruitment around senile plaques in Alzheimer's disease brain. LRRC15 is induced by EWS-WT1(+KTS) in the tumor DSRCT and may play a role in cellular invasion.

Molekulargewicht: 64 kDa (MW of target protein)