Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

BACE1 Antikörper (N-Term)

BACE1 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN635849
  • Target Alle BACE1 Antikörper anzeigen
    BACE1 (Beta-secretase 1 (BACE1))
    Bindungsspezifität
    • 16
    • 14
    • 6
    • 5
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reaktivität
    • 84
    • 52
    • 41
    • 7
    • 6
    • 5
    • 5
    • 5
    • 5
    • 5
    • 4
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    Human, Maus, Ratte
    Wirt
    • 78
    • 11
    Kaninchen
    Klonalität
    • 73
    • 16
    Polyklonal
    Konjugat
    • 57
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Dieser BACE1 Antikörper ist unkonjugiert
    Applikation
    • 53
    • 36
    • 30
    • 18
    • 14
    • 13
    • 13
    • 11
    • 11
    • 7
    • 3
    • 3
    • 3
    • 2
    • 2
    Western Blotting (WB)
    Spezifität
    BACE1 antibody was raised against the N terminal of BACE1
    Aufreinigung
    Affinity purified
    Immunogen
    BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
  • Applikationshinweise
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    BACE1 Blocking Peptide, catalog no. 33R-3496, is also available for use as a blocking control in assays to test for specificity of this BACE1 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE1 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C/-20 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    BACE1 (Beta-secretase 1 (BACE1))
    Andere Bezeichnung
    BACE1 (BACE1 Produkte)
    Synonyme
    ASP2 antikoerper, BACE antikoerper, HSPC104 antikoerper, C76936 antikoerper, Bace antikoerper, MGC145931 antikoerper, BACE1 antikoerper, zgc:77409 antikoerper, beta-secretase 1 antikoerper, beta-site APP cleaving enzyme 1 antikoerper, beta-site APP-cleaving enzyme 1 antikoerper, BACE1 antikoerper, Bace1 antikoerper, bace1 antikoerper
    Hintergrund
    Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.
    Molekulargewicht
    51 kDa (MW of target protein)
Sie sind hier:
Kundenservice