BACE1 Antikörper (N-Term)

Produktnummer ABIN635849

Der Kaninchen Polyklonal Anti-BACE1-Antikörper wurde für WB validiert. Er ist geeignet, BACE1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für BACE1 Antikörper (N-Term) (ABIN635849)

Target: BACE1 (Beta-secretase 1 (BACE1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BACE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BACE1 Antikörper

Bindungsspezifität: N-Term

Spezifität: BACE1 antibody was raised against the N terminal of BACE1

Aufreinigung: Affinity purified

Immunogen: BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BACE1 Blocking Peptide, catalog no. 33R-3496, is also available for use as a blocking control in assays to test for specificity of this BACE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BACE1

Target: BACE1 (Beta-secretase 1 (BACE1))

Andere Bezeichnung: BACE1

Hintergrund: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.

Molekulargewicht: 51 kDa (MW of target protein)