TMEM158 Antikörper (Middle Region)

Produktnummer ABIN635848

Produktdetails anti-TMEM158 Antikörper

Target: TMEM158 (Transmembrane Protein 158 (TMEM158))

Bindungsspezifität: Middle Region

Reaktivität: Maus, Ratte, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM158 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM158 antibody was raised against the middle region of TMEM158

Aufreinigung: Affinity purified

Immunogen: TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM158 Blocking Peptide, catalog no. 33R-1244, is also available for use as a blocking control in assays to test for specificity of this TMEM158 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM158 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM158

Target: TMEM158 (Transmembrane Protein 158 (TMEM158))

Andere Bezeichnung: TMEM158 (TMEM158 Produkte)

Synonyme: 2310037P21Rik antikoerper, Ris1 antikoerper, BBP antikoerper, RIS1 antikoerper, p40BBP antikoerper, transmembrane protein 158 antikoerper, transmembrane protein 158 (gene/pseudogene) antikoerper, Tmem158 antikoerper, TMEM158 antikoerper

Hintergrund: TMEM158 is the receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.

Molekulargewicht: 30 kDa (MW of target protein)