TMEM158 Antikörper (Middle Region)

Produktnummer ABIN635848

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TMEM158 in WB. Es zeigt Reaktivität gegenüber Proben von Maus, Ratte und Human.

Kurzübersicht für TMEM158 Antikörper (Middle Region) (ABIN635848)

Target: TMEM158 (Transmembrane Protein 158 (TMEM158))

Reaktivität: Maus, Ratte, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM158 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM158 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMEM158 antibody was raised against the middle region of TMEM158

Aufreinigung: Affinity purified

Immunogen: TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM158 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM158 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM158 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM158

Target: TMEM158 (Transmembrane Protein 158 (TMEM158))

Andere Bezeichnung: TMEM158

Hintergrund: TMEM158 is the receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.

Molekulargewicht: 30 kDa (MW of target protein)