NDST4 Antikörper
-
- Target Alle NDST4 Antikörper anzeigen
- NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NDST4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS
- Top Product
- Discover our top product NDST4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NDST4 Blocking Peptide, catalog no. 33R-10167, is also available for use as a blocking control in assays to test for specificity of this NDST4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDST4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))
- Andere Bezeichnung
- NDST4 (NDST4 Produkte)
- Synonyme
- NDST-4 antikoerper, NHSST4 antikoerper, 4930439H17Rik antikoerper, N-deacetylase and N-sulfotransferase 4 antikoerper, N-deacetylase/N-sulfotransferase (heparin glucosaminyl) 4 antikoerper, NDST4 antikoerper, Ndst4 antikoerper
- Hintergrund
- NDST4 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate.
- Molekulargewicht
- 101 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-