NDST4 Antikörper

Produktnummer ABIN635843

Der Kaninchen Polyklonal Anti-NDST4-Antikörper wurde für WB validiert. Er ist geeignet, NDST4 in Proben von Human und Maus zu detektieren.

Kurzübersicht für NDST4 Antikörper (ABIN635843)

Target: NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDST4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NDST4 Antikörper

Aufreinigung: Affinity purified

Immunogen: NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDST4 Blocking Peptide, (ABIN936135), is also available for use as a blocking control in assays to test for specificity of this NDST4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDST4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDST4

Target: NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))

Andere Bezeichnung: NDST4

Hintergrund: NDST4 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate.

Molekulargewicht: 101 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process