IGF-like family receptor 1 (IGFLR1) (N-Term) Antikörper
Kurzübersicht für IGF-like family receptor 1 (IGFLR1) (N-Term) Antikörper (ABIN635834)
Target
Alle IGF-like family receptor 1 (IGFLR1) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- TMEM149 antibody was raised against the N terminal of TMEM149
-
Aufreinigung
- Affinity purified
-
Immunogen
- TMEM149 antibody was raised using the N terminal of TMEM149 corresponding to a region with amino acids WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
TMEM149 Blocking Peptide, (ABIN5616668), is also available for use as a blocking control in assays to test for specificity of this TMEM149 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM149 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- IGF-like family receptor 1 (IGFLR1)
-
Andere Bezeichnung
- TMEM149
-
Hintergrund
- TMEM149 is a single-pass type I membrane protein. The exact function of TMEM149 remains unknown.
-
Molekulargewicht
- 38 kDa (MW of target protein)
Target
-