PTGIS Antikörper

Produktnummer ABIN635828

Produktdetails anti-PTGIS Antikörper

Target: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTGIS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PTGIS antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTGIS Blocking Peptide, catalog no. 33R-2493, is also available for use as a blocking control in assays to test for specificity of this PTGIS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGIS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTGIS

Target: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Andere Bezeichnung: PTGIS (PTGIS Produkte)

Synonyme: CYP8 antikoerper, CYP8A1 antikoerper, PGIS antikoerper, PTGI antikoerper, Cyp8 antikoerper, Cyp8a1 antikoerper, Pgis antikoerper, ptgisl antikoerper, PTGIS antikoerper, prostaglandin I2 synthase antikoerper, prostaglandin I2 (prostacyclin) synthase antikoerper, prostacyclin synthase antikoerper, PTGIS antikoerper, Ptgis antikoerper, ptgis antikoerper, VDBG_06319 antikoerper

Hintergrund: PTGIS is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity.

Molekulargewicht: 57 kDa (MW of target protein)