GPD2 Antikörper

Produktnummer ABIN635827

Produktdetails anti-GPD2 Antikörper

Target: GPD2 (Glycerol Phosphate Dehydrogenase 2, Mitochondrial (GPD2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPD2 Blocking Peptide, catalog no. 33R-3516, is also available for use as a blocking control in assays to test for specificity of this GPD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPD2

Target: GPD2 (Glycerol Phosphate Dehydrogenase 2, Mitochondrial (GPD2))

Andere Bezeichnung: GPD2 (GPD2 Produkte)

Synonyme: glycerol-3-phosphate dehydrogenase Gpd2 antikoerper, gpd2 antikoerper

Hintergrund: The protein encoded by this gene localizes to the inner mitochondrial membrane and catalyzes the conversion of glycerol-3-phosphate to dihydroxyacetone phosphate, using FAD as a cofactor.

Molekulargewicht: 81 kDa (MW of target protein)