GPD2 Antikörper
-
- Target Alle GPD2 Antikörper anzeigen
- GPD2 (Glycerol Phosphate Dehydrogenase 2, Mitochondrial (GPD2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG
- Top Product
- Discover our top product GPD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPD2 Blocking Peptide, catalog no. 33R-3516, is also available for use as a blocking control in assays to test for specificity of this GPD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPD2 (Glycerol Phosphate Dehydrogenase 2, Mitochondrial (GPD2))
- Andere Bezeichnung
- GPD2 (GPD2 Produkte)
- Hintergrund
- The protein encoded by this gene localizes to the inner mitochondrial membrane and catalyzes the conversion of glycerol-3-phosphate to dihydroxyacetone phosphate, using FAD as a cofactor.
- Molekulargewicht
- 81 kDa (MW of target protein)
-