TMED10 Antikörper

Produktnummer ABIN635823

Der Kaninchen Polyklonal anti-TMED10 Antikörper (ABIN635823) detektiert spezifisch TMED10 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für TMED10 Antikörper (ABIN635823)

Target: TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMED10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMED10 Antikörper

Aufreinigung: Affinity purified

Immunogen: TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMED10 Blocking Peptide, (ABIN939901), is also available for use as a blocking control in assays to test for specificity of this TMED10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMED10

Target: TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))

Andere Bezeichnung: TMED10

Hintergrund: This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cisternae and is involved in vesicular protein trafficking.

Molekulargewicht: 24 kDa (MW of target protein)