Receptor Accessory Protein 1 Antikörper (Middle Region)
-
- Target Alle Receptor Accessory Protein 1 (REEP1) Antikörper anzeigen
- Receptor Accessory Protein 1 (REEP1)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Maus, Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Receptor Accessory Protein 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- REEP1 antibody was raised against the middle region of REEP1
- Aufreinigung
- Affinity purified
- Immunogen
- REEP1 antibody was raised using the middle region of REEP1 corresponding to a region with amino acids AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI
- Top Product
- Discover our top product REEP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
REEP1 Blocking Peptide, catalog no. 33R-1288, is also available for use as a blocking control in assays to test for specificity of this REEP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REEP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Receptor Accessory Protein 1 (REEP1)
- Andere Bezeichnung
- REEP1 (REEP1 Produkte)
- Synonyme
- C2orf23 antikoerper, HMN5B antikoerper, SPG31 antikoerper, D6Ertd253e antikoerper, RGD1305230 antikoerper, receptor accessory protein 1 antikoerper, REEP1 antikoerper, Reep1 antikoerper
- Hintergrund
- REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.
- Molekulargewicht
- 22 kDa (MW of target protein)
-