GALNT5 Antikörper

Produktnummer ABIN635812

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GALNT5 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für GALNT5 Antikörper (ABIN635812)

Target: GALNT5 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALNT5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GALNT5 Antikörper

Aufreinigung: Affinity purified

Immunogen: GALNT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALNT5 Blocking Peptide, (ABIN937959), is also available for use as a blocking control in assays to test for specificity of this GALNT5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GALNT5

Target: GALNT5 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5))

Andere Bezeichnung: GALNT5

Hintergrund: GALNT5 can catalyze the initial reaction in O-linked oligosaccharide biosynthesis,the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. GALNT5 has activity toward EA2 peptide substrate, but it has a weak activity toward Muc2 or Muc1b substrates.

Molekulargewicht: 106 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process