BTN2A1 Antikörper (N-Term)

Produktnummer ABIN635811

Produktdetails anti-BTN2A1 Antikörper

Target: BTN2A1 (butyrophilin, Subfamily 2, Member A1 (BTN2A1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BTN2A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BTN2 A1 antibody was raised against the N terminal of BTN2 1

Aufreinigung: Affinity purified

Immunogen: BTN2 A1 antibody was raised using the N terminal of BTN2 1 corresponding to a region with amino acids SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BTN2A1 Blocking Peptide, catalog no. 33R-8900, is also available for use as a blocking control in assays to test for specificity of this BTN2A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTN0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BTN2A1

Target: BTN2A1 (butyrophilin, Subfamily 2, Member A1 (BTN2A1))

Andere Bezeichnung: BTN2A1 (BTN2A1 Produkte)

Synonyme: BK14H9.1 antikoerper, BT2.1 antikoerper, BTF1 antikoerper, DJ3E1.1 antikoerper, BTN2A1 antikoerper, btf1 antikoerper, bt2.1 antikoerper, BTN2A2 antikoerper, butyrophilin subfamily 2 member A1 antikoerper, butyrophilin subfamily 2 member A1 S homeolog antikoerper, butyrophilin, subfamily 2, member A1 antikoerper, BTN2A1 antikoerper, btn2a1.S antikoerper, btn2a1 antikoerper, LOC100409586 antikoerper

Hintergrund: This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin geneuperfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Activated T Cell Proliferation