CEACAM4 Antikörper (N-Term)

Produktnummer ABIN635809

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch CEACAM4 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CEACAM4 Antikörper (N-Term) (ABIN635809)

Target: CEACAM4 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 4 (CEACAM4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CEACAM4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CEACAM4 Antikörper

Bindungsspezifität: N-Term

Spezifität: CEACAM4 antibody was raised against the N terminal of CEACAM4

Aufreinigung: Affinity purified

Immunogen: CEACAM4 antibody was raised using the N terminal of CEACAM4 corresponding to a region with amino acids FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CEACAM4 Blocking Peptide, (ABIN938478), is also available for use as a blocking control in assays to test for specificity of this CEACAM4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CEACAM4

Target: CEACAM4 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 4 (CEACAM4))

Andere Bezeichnung: CEACAM4

Hintergrund: CEACAM4 belongs to the immunoglobulin superfamily.

Molekulargewicht: 26 kDa (MW of target protein)