BTN1A1 Antikörper (N-Term)

Produktnummer ABIN635808

Dieses Anti-BTN1A1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von BTN1A1 in WB. Geeignet für Human.

Kurzübersicht für BTN1A1 Antikörper (N-Term) (ABIN635808)

Target: BTN1A1 (Butyrophilin, Subfamily 1, Member A1 (BTN1A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BTN1A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BTN1A1 Antikörper

Bindungsspezifität: N-Term

Spezifität: BTN1 A1 antibody was raised against the N terminal of BTN1 1

Aufreinigung: Affinity purified

Immunogen: BTN1 A1 antibody was raised using the N terminal of BTN1 1 corresponding to a region with amino acids LPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BTN1A1 Blocking Peptide, (ABIN5612374), is also available for use as a blocking control in assays to test for specificity of this BTN1A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTN0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BTN1A1

Target: BTN1A1 (Butyrophilin, Subfamily 1, Member A1 (BTN1A1))

Andere Bezeichnung: BTN1A1

Hintergrund: Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Activated T Cell Proliferation