ISLR2 Antikörper (N-Term)

Produktnummer ABIN635806

Produktdetails anti-ISLR2 Antikörper

Target: ISLR2 (Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 (ISLR2))

Bindungsspezifität: N-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ISLR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ISLR2 antibody was raised against the N terminal of ISLR2

Aufreinigung: Affinity purified

Immunogen: ISLR2 antibody was raised using the N terminal of ISLR2 corresponding to a region with amino acids PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ISLR2 Blocking Peptide, catalog no. 33R-7074, is also available for use as a blocking control in assays to test for specificity of this ISLR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISLR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ISLR2

Target: ISLR2 (Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 (ISLR2))

Andere Bezeichnung: ISLR2 (ISLR2 Produkte)

Synonyme: LINX antikoerper, B930052A04Rik antikoerper, Linx antikoerper, Mbu-3 antikoerper, mKIAA1465 antikoerper, immunoglobulin superfamily containing leucine rich repeat 2 antikoerper, immunoglobulin superfamily containing leucine-rich repeat 2 antikoerper, ISLR2 antikoerper, Islr2 antikoerper

Hintergrund: ISLR2 is a single-pass membrane protein. It contains 1 Ig-like (immunoglobulin-like) domain and 5 LRR (leucine-rich) repeats. The exact function of ISLR2 remains unknown.

Molekulargewicht: 79 kDa (MW of target protein)

Pathways: Regulation of Cell Size