SLAMF6 Antikörper (N-Term)
-
- Target Alle SLAMF6 Antikörper anzeigen
- SLAMF6 (SLAM Family Member 6 (SLAMF6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLAMF6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLAMF6 antibody was raised against the N terminal of SLAMF6
- Aufreinigung
- Affinity purified
- Immunogen
- SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK
- Top Product
- Discover our top product SLAMF6 Primärantikörper
-
anti-SLAM Family Member 6 (SLAMF6) (AA 22-226) antibody
SLAMF6 Reaktivität: Human WB, ELISA, FACS, IHC, ICC, Neut Wirt: Maus Monoclonal 2F1C9 unconjugated
anti-SLAM Family Member 6 (SLAMF6) (AA 248-331) antibodySLAMF6 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-SLAM Family Member 6 (SLAMF6) (AA 1-271) antibodySLAMF6 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-SLAM Family Member 6 (SLAMF6) antibodySLAMF6 Reaktivität: Human FACS, ICC, IP Wirt: Maus Monoclonal hsF6-4-20 unconjugated
anti-SLAM Family Member 6 (SLAMF6) antibody (PE)SLAMF6 Reaktivität: Human FACS Wirt: Maus Monoclonal hsF6-4-20 PE
anti-SLAM Family Member 6 (SLAMF6) (AA 152-224) antibodySLAMF6 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-SLAM Family Member 6 (SLAMF6) (AA 51-150) antibodySLAMF6 Reaktivität: Maus WB, ELISA, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-SLAM Family Member 6 (SLAMF6) (AA 22-226) antibodySLAMF6 Reaktivität: Human ELISA, FACS Wirt: Kaninchen Monoclonal DM159 unconjugated
anti-SLAM Family Member 6 (SLAMF6) (Extracellular Domain) antibodySLAMF6 Reaktivität: Human FACS Wirt: Maus Monoclonal NT-7 unconjugated
anti-SLAM Family Member 6 (SLAMF6) antibodySLAMF6 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLAMF6 Blocking Peptide, catalog no. 33R-6685, is also available for use as a blocking control in assays to test for specificity of this SLAMF6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLAMF6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLAMF6 (SLAM Family Member 6 (SLAMF6))
- Andere Bezeichnung
- SLAMF6 (SLAMF6 Produkte)
- Synonyme
- SLAMF6 antikoerper, CD352 antikoerper, KALI antikoerper, KALIb antikoerper, Ly108 antikoerper, NTB-A antikoerper, NTBA antikoerper, SF2000 antikoerper, KAL1 antikoerper, KAL1b antikoerper, RGD1561848 antikoerper, SLAM family member 6 antikoerper, SLAMF6 antikoerper, Slamf6 antikoerper
- Hintergrund
- SLAMF6 is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. SLAMF6 is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.
- Molekulargewicht
- 34 kDa (MW of target protein)
-
