-
- Target Alle TBL2 Antikörper anzeigen
- TBL2 (Transducin (Beta)-Like 2 (TBL2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TBL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK
- Top Product
- Discover our top product TBL2 Primärantikörper
-
anti-Transducin (Beta)-Like 2 (TBL2) (AA 1-447) antibody
TBL2 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Transducin (Beta)-Like 2 (TBL2) (AA 1-447) antibodyTBL2 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Transducin (Beta)-Like 2 (TBL2) (AA 43-72), (N-Term) antibodyTBL2 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB32541 unconjugated
anti-Transducin (Beta)-Like 2 (TBL2) (C-Term) antibodyTBL2 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Transducin (Beta)-Like 2 (TBL2) (AA 100-430) antibodyTBL2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Transducin (Beta)-Like 2 (TBL2) (AA 38-87) antibodyTBL2 Reaktivität: Human, Maus, Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Transducin (Beta)-Like 2 (TBL2) (AA 50-80), (N-Term) antibodyTBL2 Reaktivität: Human WB, EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TBL2 Blocking Peptide, catalog no. 33R-8181, is also available for use as a blocking control in assays to test for specificity of this TBL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TBL2 (Transducin (Beta)-Like 2 (TBL2))
- Andere Bezeichnung
- TBL2 (TBL2 Produkte)
- Synonyme
- wu:fa96f08 antikoerper, tbl2 antikoerper, MGC53692 antikoerper, TBL2 antikoerper, MGC79804 antikoerper, MGC140759 antikoerper, DKFZp469O1728 antikoerper, WBSCR13 antikoerper, WS-betaTRP antikoerper, C76179 antikoerper, WS-bTRP antikoerper, transducin (beta)-like 2 antikoerper, transducin (beta)-like 2 L homeolog antikoerper, transducin beta like 2 antikoerper, tbl2 antikoerper, tbl2.L antikoerper, TBL2 antikoerper, Tbl2 antikoerper
- Hintergrund
- TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.
- Molekulargewicht
- 49 kDa (MW of target protein)
-
Sie sind hier:
