TBL2 Antikörper

Produktnummer ABIN635791

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TBL2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für TBL2 Antikörper (ABIN635791)

Target: TBL2 (Transducin (Beta)-Like 2 (TBL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TBL2 Antikörper

Aufreinigung: Affinity purified

Immunogen: TBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBL2 Blocking Peptide, (ABIN5616522), is also available for use as a blocking control in assays to test for specificity of this TBL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBL2

Target: TBL2 (Transducin (Beta)-Like 2 (TBL2))

Andere Bezeichnung: TBL2

Hintergrund: TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.

Molekulargewicht: 49 kDa (MW of target protein)