ADAM19 Antikörper

Produktnummer ABIN635789

Der Kaninchen-Polyklonal Anti-ADAM19-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von ADAM19 in Proben aus Human, Maus und Ratte. }

Kurzübersicht für ADAM19 Antikörper (ABIN635789)

Target: ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAM19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADAM19 Antikörper

Aufreinigung: Affinity purified

Immunogen: ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAM19 Blocking Peptide, (ABIN938911), is also available for use as a blocking control in assays to test for specificity of this ADAM19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAM19

Target: ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))

Andere Bezeichnung: ADAM19

Hintergrund: ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation.

Molekulargewicht: 82 kDa (MW of target protein)