TMTC1 Antikörper (Middle Region)

Produktnummer ABIN635781

Produktdetails anti-TMTC1 Antikörper

Target: TMTC1 (Transmembrane and Tetratricopeptide Repeat Containing 1 (TMTC1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMTC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMTC1 antibody was raised against the middle region of TMTC1

Aufreinigung: Affinity purified

Immunogen: TMTC1 antibody was raised using the middle region of TMTC1 corresponding to a region with amino acids LFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMTC1 Blocking Peptide, catalog no. 33R-4937, is also available for use as a blocking control in assays to test for specificity of this TMTC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMTC1

Target: TMTC1 (Transmembrane and Tetratricopeptide Repeat Containing 1 (TMTC1))

Andere Bezeichnung: TMTC1 (TMTC1 Produkte)

Synonyme: OLF antikoerper, TMTC1A antikoerper, Arg99 antikoerper, BC023818 antikoerper, RGD1564868 antikoerper, transmembrane and tetratricopeptide repeat containing 1 antikoerper, TMTC1 antikoerper, Tmtc1 antikoerper

Hintergrund: TMTC1 is a multi-pass membrane protein. It belongs to the TMTC family and contains 10 TPR repeats. The exact function of TMTC1 remains unknown.

Molekulargewicht: 87 kDa (MW of target protein)