TMTC1 Antikörper (Middle Region)
Kurzübersicht für TMTC1 Antikörper (Middle Region) (ABIN635781)
Target
Reaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- Middle Region
-
Spezifität
- TMTC1 antibody was raised against the middle region of TMTC1
-
Aufreinigung
- Affinity purified
-
Immunogen
- TMTC1 antibody was raised using the middle region of TMTC1 corresponding to a region with amino acids LFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYV
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
TMTC1 Blocking Peptide, (ABIN940323), is also available for use as a blocking control in assays to test for specificity of this TMTC1 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC1 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- TMTC1 (Transmembrane and Tetratricopeptide Repeat Containing 1 (TMTC1))
-
Andere Bezeichnung
- TMTC1
-
Hintergrund
- TMTC1 is a multi-pass membrane protein. It belongs to the TMTC family and contains 10 TPR repeats. The exact function of TMTC1 remains unknown.
-
Molekulargewicht
- 87 kDa (MW of target protein)
Target
-