FCRLA Antikörper (C-Term)

Produktnummer ABIN635774

Produktdetails anti-FCRLA Antikörper

Target: FCRLA (Fc Receptor-Like A (FCRLA))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FCRLA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FCRLA antibody was raised against the C terminal of FCRLA

Aufreinigung: Affinity purified

Immunogen: FCRLA antibody was raised using the C terminal of FCRLA corresponding to a region with amino acids MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FCRLA Blocking Peptide, catalog no. 33R-6273, is also available for use as a blocking control in assays to test for specificity of this FCRLA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCRLA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FCRLA

Target: FCRLA (Fc Receptor-Like A (FCRLA))

Andere Bezeichnung: FCRLA (FCRLA Produkte)

Synonyme: FCRL antikoerper, FCRL1 antikoerper, FCRLM1 antikoerper, FCRLX antikoerper, FCRLb antikoerper, FCRLc1 antikoerper, FCRLc2 antikoerper, FCRLd antikoerper, FCRLe antikoerper, FCRX antikoerper, FREB antikoerper, BB219290 antikoerper, Fcrlm1 antikoerper, Fcrx antikoerper, Freb1 antikoerper, mFREB antikoerper, mFcrX antikoerper, RGD1306176 antikoerper, Fc receptor like A antikoerper, Fc receptor-like A antikoerper, FCRLA antikoerper, Fcrla antikoerper

Hintergrund: Receptors for the Fc fragment of IgG, or FCGRs, are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLA may be implicated in B-cell differentiation and lymphomagenesis.

Molekulargewicht: 41 kDa (MW of target protein)