FCRLA Antikörper (C-Term)

Produktnummer ABIN635774

Der Kaninchen Polyklonal Anti-FCRLA-Antikörper wurde für WB validiert. Er ist geeignet, FCRLA in Proben von Human zu detektieren.

Kurzübersicht für FCRLA Antikörper (C-Term) (ABIN635774)

Target: FCRLA (Fc Receptor-Like A (FCRLA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FCRLA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FCRLA Antikörper

Bindungsspezifität: C-Term

Spezifität: FCRLA antibody was raised against the C terminal of FCRLA

Aufreinigung: Affinity purified

Immunogen: FCRLA antibody was raised using the C terminal of FCRLA corresponding to a region with amino acids MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FCRLA Blocking Peptide, (ABIN5613565), is also available for use as a blocking control in assays to test for specificity of this FCRLA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCRLA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FCRLA

Target: FCRLA (Fc Receptor-Like A (FCRLA))

Andere Bezeichnung: FCRLA

Hintergrund: Receptors for the Fc fragment of IgG, or FCGRs, are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLA may be implicated in B-cell differentiation and lymphomagenesis.

Molekulargewicht: 41 kDa (MW of target protein)