HAVCR1 Antikörper (N-Term)

Produktnummer ABIN635773

Produktdetails anti-HAVCR1 Antikörper

Target: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Bindungsspezifität: N-Term

Reaktivität: Hepatitis A Virus (HAV)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAVCR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HAVCR1 antibody was raised against the N terminal of HAVCR1

Aufreinigung: Affinity purified

Immunogen: HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAVCR1 Blocking Peptide, catalog no. 33R-1716, is also available for use as a blocking control in assays to test for specificity of this HAVCR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAVCR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAVCR1

Target: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Andere Bezeichnung: HAVCR1 (HAVCR1 Produkte)

Synonyme: HAVCR antikoerper, HAVCR-1 antikoerper, KIM-1 antikoerper, KIM1 antikoerper, TIM antikoerper, TIM-1 antikoerper, TIM1 antikoerper, TIMD-1 antikoerper, TIMD1 antikoerper, Kim1 antikoerper, HAVCR1 antikoerper, LOC100226241 antikoerper, AI503787 antikoerper, Tim1 antikoerper, Timd1 antikoerper, hepatitis A virus cellular receptor 1 antikoerper, hepatitis A virus cellular receptor 1 homolog antikoerper, HAVCR1 antikoerper, Havcr1 antikoerper, LOC100226241 antikoerper

Substanzklasse: Virus

Hintergrund: HAVCR1 may play a role in T-helper cell development and the regulation of asthma and allergic diseases. HAVCR1 is the receptor for TIMD4. In case of human hepatitis A virus (HHAV) infection, it functions as a cell-surface receptor for the virus.

Molekulargewicht: 39 kDa (MW of target protein)