TMEM35 Antikörper (C-Term)

Produktnummer ABIN635766

Produktdetails anti-TMEM35 Antikörper

Target: TMEM35 (Transmembrane Protein 35 (TMEM35))

Bindungsspezifität: C-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM35 antibody was raised against the C terminal of TMEM35

Aufreinigung: Affinity purified

Immunogen: TMEM35 antibody was raised using the C terminal of TMEM35 corresponding to a region with amino acids VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM35 Blocking Peptide, catalog no. 33R-9525, is also available for use as a blocking control in assays to test for specificity of this TMEM35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM35

Target: TMEM35 (Transmembrane Protein 35 (TMEM35))

Andere Bezeichnung: TMEM35 (TMEM35 Produkte)

Synonyme: Xp18 antikoerper, flj14084 antikoerper, wu:fc41e12 antikoerper, zgc:110832 antikoerper, 9030603L14Rik antikoerper, AI841526 antikoerper, PMP52 antikoerper, RSEP4 antikoerper, transmembrane protein 35A antikoerper, transmembrane protein 35 antikoerper, TMEM35A antikoerper, tmem35 antikoerper, tmem35a antikoerper, Tmem35 antikoerper, TMEM35 antikoerper, Tmem35a antikoerper

Hintergrund: TMEM35 is a multi-pass membrane protein. The exact function of TMEM35 remains unknown.

Molekulargewicht: 18 kDa (MW of target protein)