TMEM35 Antikörper (C-Term)

Produktnummer ABIN635766

Der Kaninchen Polyklonal anti-TMEM35 Antikörper (ABIN635766) detektiert spezifisch TMEM35 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für TMEM35 Antikörper (C-Term) (ABIN635766)

Target: TMEM35 (Transmembrane Protein 35 (TMEM35))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM35 Antikörper

Bindungsspezifität: C-Term

Spezifität: TMEM35 antibody was raised against the C terminal of TMEM35

Aufreinigung: Affinity purified

Immunogen: TMEM35 antibody was raised using the C terminal of TMEM35 corresponding to a region with amino acids VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM35 Blocking Peptide, (ABIN5616678), is also available for use as a blocking control in assays to test for specificity of this TMEM35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM35

Target: TMEM35 (Transmembrane Protein 35 (TMEM35))

Andere Bezeichnung: TMEM35

Hintergrund: TMEM35 is a multi-pass membrane protein. The exact function of TMEM35 remains unknown.

Molekulargewicht: 18 kDa (MW of target protein)