Tetraspanin 15 Antikörper (C-Term)

Produktnummer ABIN635763

Dieses Anti-Tetraspanin 15-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Tetraspanin 15 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für Tetraspanin 15 Antikörper (C-Term) (ABIN635763)

Target: Tetraspanin 15 (TSPAN15)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tetraspanin 15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Tetraspanin 15 Antikörper

Bindungsspezifität: C-Term

Spezifität: Tetraspanin 15 antibody was raised against the C terminal of TSPAN15

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 15 antibody was raised using the C terminal of TSPAN15 corresponding to a region with amino acids LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 15 Blocking Peptide, (ABIN940361), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tetraspanin 15

Target: Tetraspanin 15 (TSPAN15)

Andere Bezeichnung: Tetraspanin 15

Hintergrund: TSPAN15 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.

Molekulargewicht: 33 kDa (MW of target protein)