TSPAN12 Antikörper (Middle Region)

Produktnummer ABIN635761

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TSPAN12 in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte, Maus und Hund.

Kurzübersicht für TSPAN12 Antikörper (Middle Region) (ABIN635761)

Target: TSPAN12 (Tetraspanin 12 (TSPAN12))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSPAN12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TSPAN12 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Tetraspanin 12 antibody was raised against the middle region of TSPAN12

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 12 antibody was raised using the middle region of TSPAN12 corresponding to a region with amino acids EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 12 Blocking Peptide, (ABIN937796), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSPAN12

Target: TSPAN12 (Tetraspanin 12 (TSPAN12))

Andere Bezeichnung: Tetraspanin 12

Hintergrund: TSPAN12 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Molekulargewicht: 35 kDa (MW of target protein)