TSPAN31 Antikörper (Middle Region)

Produktnummer ABIN635760

Der Kaninchen Polyklonal anti-TSPAN31 Antikörper (ABIN635760) detektiert spezifisch TSPAN31 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TSPAN31 Antikörper (Middle Region) (ABIN635760)

Target: TSPAN31 (Tetraspanin 31 (TSPAN31))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSPAN31 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TSPAN31 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Tetraspanin 31 antibody was raised against the middle region of TSPAN31

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 31 antibody was raised using the middle region of TSPAN31 corresponding to a region with amino acids CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 31 Blocking Peptide, (ABIN937205), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 31 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN31 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSPAN31

Target: TSPAN31 (Tetraspanin 31 (TSPAN31))

Andere Bezeichnung: Tetraspanin 31

Hintergrund: TSPAN31 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.

Molekulargewicht: 23 kDa (MW of target protein)