Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

PGAP3 Antikörper (N-Term)

Der Kaninchen Polyklonal Anti-PGAP3-Antikörper wurde für WB validiert. Er ist geeignet, PGAP3 in Proben von Human zu detektieren.
Produktnummer ABIN635756

Kurzübersicht für PGAP3 Antikörper (N-Term) (ABIN635756)

Target

Alle PGAP3 Antikörper anzeigen
PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))

Reaktivität

  • 21
  • 4
  • 3
  • 3
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
Human

Wirt

  • 21
Kaninchen

Klonalität

  • 21
Polyklonal

Konjugat

  • 10
  • 4
  • 4
  • 1
  • 1
  • 1
Dieser PGAP3 Antikörper ist unkonjugiert

Applikation

  • 21
  • 17
  • 13
  • 9
  • 9
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 7
    • 5
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    PERLD1 antibody was raised against the N terminal of PERLD1

    Aufreinigung

    Affinity purified

    Immunogen

    PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    PERLD1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this PERLD1 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERLD1 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))

    Andere Bezeichnung

    PERLD1

    Hintergrund

    PERLD1 is involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins.

    Molekulargewicht

    36 kDa (MW of target protein)

    Pathways

    Inositol Metabolic Process
Sie sind hier:
Chat with us!