LRRTM1 Antikörper (Middle Region)

Produktnummer ABIN635753

Der Kaninchen-Polyklonal Anti-LRRTM1-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von LRRTM1 in Proben aus Human, Maus und Ratte. }

Kurzübersicht für LRRTM1 Antikörper (Middle Region) (ABIN635753)

Target: LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRTM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LRRTM1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LRRTM1 antibody was raised against the middle region of LRRTM1

Aufreinigung: Affinity purified

Immunogen: LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRTM1 Blocking Peptide, (ABIN937030), is also available for use as a blocking control in assays to test for specificity of this LRRTM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRTM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRTM1

Target: LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1))

Andere Bezeichnung: LRRTM1

Hintergrund: LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: Synaptic Membrane