alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) (C-Term) Antikörper

Produktnummer ABIN635748

Dieses Anti--Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) (C-Term) Antikörper (ABIN635748)

Target: alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: C-Term

Spezifität: ST6 GALNAC3 antibody was raised against the C terminal of ST6 ALNAC3

Aufreinigung: Affinity purified

Immunogen: ST6 GALNAC3 antibody was raised using the C terminal of ST6 ALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST6GALNAC3 Blocking Peptide, (ABIN939268), is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)

Andere Bezeichnung: ST6GALNAC3

Hintergrund: ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids.

Molekulargewicht: 35 kDa (MW of target protein)