CHST13 Antikörper

Produktnummer ABIN635744

Der Kaninchen Polyklonal anti-CHST13 Antikörper wird verwendet zum Nachweis von CHST13 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CHST13 Antikörper (ABIN635744)

Target: CHST13 (Carbohydrate (Chondroitin 4) Sulfotransferase 13 (CHST13))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHST13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHST13 Antikörper

Aufreinigung: Affinity purified

Immunogen: CHST13 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHST13 Blocking Peptide, (ABIN936722), is also available for use as a blocking control in assays to test for specificity of this CHST13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHST13

Target: CHST13 (Carbohydrate (Chondroitin 4) Sulfotransferase 13 (CHST13))

Andere Bezeichnung: CHST13

Hintergrund: CHST13 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process